PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca30054.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family NAC
Protein Properties Length: 289aa    MW: 33126.5 Da    PI: 7.5328
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca30054.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM140.88.3e-44111383128
         NAM   3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgk.rknratksgyWkatgkdkevlsk..kge 98 
                 pGfrF+Pt+eel+++yLk+ v +kkl++ ++i  +diy+++PwdLp  ++ +e+ewyf ++rd+k+ +g  r++r+t+ g+Wkatg+d++++s    ++
  Dca30054.1  11 PGFRFKPTEEELISFYLKNIVYDKKLHI-DIIGFLDIYQYDPWDLPGLARIGEREWYFVVPRDRKHFNGCgRPRRTTEYGFWKATGSDRKIVSMsePKR 108
                 9***************************.99***************8778899*************997449999****************99866677 PP

         NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                 ++g +ktLv+ykgrap+g+ktdW+m+eyrl
  Dca30054.1 109 VIGFRKTLVYYKGRAPRGSKTDWIMNEYRL 138
                 8***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100550.6729156IPR003441NAC domain
SuperFamilySSF1019417.45E-5110156IPR003441NAC domain
PfamPF023652.1E-2211138IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MDKSVLGFGL PGFRFKPTEE ELISFYLKNI VYDKKLHIDI IGFLDIYQYD PWDLPGLARI  60
GEREWYFVVP RDRKHFNGCG RPRRTTEYGF WKATGSDRKI VSMSEPKRVI GFRKTLVYYK  120
GRAPRGSKTD WIMNEYRLPD NCALHKEAVL CKVYRKATSL RELEERASKE EANEEHTTQQ  180
YPTSPSISFS NCTTSINNGV DHQEDFSPTA FMSTSDHTLT LKREVNEGIV SSNSSNTIQL  240
PFGRDTLGTL EVPKSGFDLI HDPFLSQSCS PWLENLLNFS SPTMAQVVL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-411115617168Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010690266.11e-118PREDICTED: NAC domain-containing protein 67
TrEMBLA0A0K9QXX31e-122A0A0K9QXX3_SPIOL; Uncharacterized protein
STRINGGLYMA12G02540.11e-101(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G17040.14e-92NAC domain containing protein 36